Protein coding transcript 131841

• Transcript: Ll_transcript_66809
• CDS coordinates: 53-610 (+)
• Peptide sequence: MSDTVSHAWNKYLLQLQLHPLRTKAITAAVLAGFSDAVAQKIAGAKKLQLRRLLLFVLYGFAYSGPFGHFLHKLMDKIFKEQKGSDTVAKKVILEQITSSPWNNFFFLMYYGLVIEGRPWSEVFSKVKKGYPTVQLTAWKFWPIVAWVNYQYMPLQFRVLFHSSIAACWGIFLNLKARSGAIKKD*
• ORF Type: complete

Annotations of Ll_transcript_66809

• Blastp: Peroxisomal membrane protein PMP22 from Arabidopsis with 60% of identity
• Blastx: Peroxisomal membrane protein PMP22 from Arabidopsis with 60% of identity
• Eggnog: Peroxisomal membrane protein(ENOG4111SYH)
• Kegg: Link to kegg annotations (AT4G04470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459448.1)
• Pfam: Mpv17 / PMP22 family (PF04117.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;