Transcript | Ll_transcript_66743 |
---|---|
CDS coordinates | 117-548 (+) |
Peptide sequence | MGKPRGIRTARKHVNHRRVQKWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS* |
ORF Type | complete |
Blastp | 40S ribosomal protein S23 from Spodoptera with 96.5% of identity |
---|---|
Blastx | 40S ribosomal protein S23 from Spodoptera with 96.5% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_007162723.1) |
Pfam | Ribosomal protein S12/S23 (PF00164.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer