Protein coding transcript 131849

• Transcript: Ll_transcript_66743
• CDS coordinates: 117-548 (+)
• Peptide sequence: MGKPRGIRTARKHVNHRRVQKWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS*
• ORF Type: complete

Annotations of Ll_transcript_66743

• Blastp: 40S ribosomal protein S23 from Spodoptera with 96.5% of identity
• Blastx: 40S ribosomal protein S23 from Spodoptera with 96.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007162723.1)
• Pfam: Ribosomal protein S12/S23 (PF00164.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;