Protein coding transcript 131850

• Transcript: Ll_transcript_66729
• CDS coordinates: 69-569 (+)
• Peptide sequence: MELYYNRRILLLNQELPFYSISITPDIEPPTTATSVYGSDSQLPPRPIFSSGVAYAFIIILASLLLISIILYMRRDHSSSHHHPSRNERVVPTASMTIPAQQVEDCVICLEEFREGEKAKMILYCNHVFHPHCIDTWLDKHVTCPVCRCNKLSEVKVADENGVGTE*
• ORF Type: complete

Annotations of Ll_transcript_66729

• Blastp: RING-H2 finger protein ATL57 from Arabidopsis with 45.98% of identity
• Blastx: RING-H2 finger protein ATL57 from Arabidopsis with 55.38% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G27940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451971.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;