Protein coding transcript 131854

• Transcript: Ll_transcript_66758
• CDS coordinates: 3-530 (+)
• Peptide sequence: IKILDTGLEEGQGNLAKTTALKKVNPKLKTLVAIGGWSEGSVKYSAVVASPNLRANFIKSALALVKKYGFDGFDLDWEYPAQRGGVAADKANYVQLLKEFRAVWDKEGLILTAAVAASGSSVDISYDVPALSKYLDLINVMTYDLHGSWDGVTGQNAPLYASSKDVSSAQKQLNVD
• ORF Type: internal

Annotations of Ll_transcript_66758

• Blastp: Probable chitinase 2 from Sophophora with 49.4% of identity
• Blastx: Probable chitinase 2 from Sophophora with 49.4% of identity
• Eggnog: chitinase(COG3325)
• Kegg: Link to kegg annotations (Dmel_CG2054)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020974317.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;