Protein coding transcript 131858

• Transcript: Ll_transcript_66800
• CDS coordinates: 238-1200 (+)
• Peptide sequence: MGHKNTFTLTFLVITFIFLLPVFSNTPPKATPFKRMLALVQQEPVILKYHNGPLLKGNVTVSVHWYGHFTPTQRSIIIDFFQSLNTSSATHQHHHPPSPSAFSWWQTTATYRGGPCTLIVGDQTLDDNYSLGKTIKTTELISLASKSKKTSNSNNIHVLLTASDVEVEDFCMNQCGTHLPGRVEKGKTVYAWVGNPMSQCPGECAWPFHQPLYGPQSPPLVAPNGDVGVDGMVISLATVLAGAVTNPFSNGYYQGVESAPLEAVSACTGIFGKDAYPGYPGNVLVDNTTGASYNAVGVNGRKFLLPAMWDPITSKCKALV*
• ORF Type: complete

Annotations of Ll_transcript_66800

• Blastp: Protein EXORDIUM-like 2 from Arabidopsis with 60.76% of identity
• Blastx: Protein EXORDIUM-like 2 from Arabidopsis with 60.76% of identity
• Eggnog: phosphate-induced protein 1 conserved region domain containing protein, expressed(ENOG41107QF)
• Kegg: Link to kegg annotations (AT5G64260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415306.1)
• Pfam: Phosphate-induced protein 1 conserved region (PF04674.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;