Protein coding transcript 131860

• Transcript: Ll_transcript_66724
• CDS coordinates: 820-1197 (+)
• Peptide sequence: MQVTLILPLTGPQYSEKVAENCVAILKSLGVYTKEEEKATKKFLSVFKKETFTPGSSIFFTVLHQGSLAISFSKDACIPKVEAAIIKNKALSEAVLESMIGENGVSPAAKKSLATRLSKLFKGLC*
• ORF Type: complete

Annotations of Ll_transcript_66724

• Blastp: Chalcone--flavonone isomerase 2 from Lotus with 76.23% of identity
• Blastx: Chalcone--flavonone isomerase 2 from Lotus with 71.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441643.1)
• Pfam: Chalcone-flavanone isomerase (PF02431.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;