Protein coding transcript 131864

• Transcript: Ll_transcript_269837
• CDS coordinates: 1-744 (+)
• Peptide sequence: LTNEHLIKDGLALEFLIELFVTYKQEVGNAHLLTVLKKGGLEGRLMDFLPPNKRTEENLRAQFEEKGLSDVVKLHLAQASQEAKRNLEIQLHDDFNDNKNMKEIISNIKELSSKHDIPEHEIIVLVWTVVMTQVEWNKKEELLADQALKHLKQYSPLFSAFSTTARSELALMLKVQEYCYENMNFMRVFQKIILLFYKTDVLTEEVILKWYKEGHSKGKTTFLEQMKKFIEWLQNAEEESESGEDED*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269837

• Blastp: Protein krasavietz from Sophophora with 67.23% of identity
• Blastx: Protein krasavietz from Sophophora with 67.23% of identity
• Eggnog: Basic leucine zipper and W2(ENOG410XR08)
• Kegg: Link to kegg annotations (Dmel_CG2922)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020219178.1)
• Pfam: eIF4-gamma/eIF5/eIF2-epsilon (PF02020.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;