Protein coding transcript 131866

• Transcript: Ll_transcript_269877
• CDS coordinates: 54-578 (+)
• Peptide sequence: MSERESDNGNSKPHLIFAYGTLKQGFPNYALMQDLITDNDAVLIGTFSTHQPYPLVCGPHGIPYLINIPGSGHQVKGELYAVSRWALVRLDEFEGVSVGYYERLPVTVVNDGDGGATVEEKEAEAYFGHRKFGERLWKKNGEVGMREYGEKEAGNYVRKEDRPEKRNTILDQFL*
• ORF Type: complete

Annotations of Ll_transcript_269877

• Blastp: Putative gamma-glutamylcyclotransferase At3g02910 from Arabidopsis with 45.57% of identity
• Blastx: Putative gamma-glutamylcyclotransferase At3g02910 from Arabidopsis with 45.57% of identity
• Eggnog: CONTAINS InterPro DOMAIN s Butirosin biosynthesis, BtrG-like (InterPro IPR013024), AIG2-like (InterPro IPR009288)(ENOG410Y5AT)
• Kegg: Link to kegg annotations (AT3G02910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422855.1)
• Pfam: Gamma-glutamyl cyclotransferase, AIG2-like (PF06094.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;