Protein coding transcript 131869

• Transcript: Ll_transcript_269854
• CDS coordinates: 3-329 (+)
• Peptide sequence: IDIFDEDGNGEVDFKEFIQGVSQFSVKGDKESKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTILFADKDEDGKINFEEFCSVVGNTDIHKKMV
• ORF Type: internal

Annotations of Ll_transcript_269854

• Blastp: Calcineurin subunit B type 1 from Sophophora with 94.5% of identity
• Blastx: Calcineurin subunit B type 1 from Sophophora with 94.5% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (Dmel_CG4209)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016162896.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;