Protein coding transcript 131870

• Transcript: Ll_transcript_269849
• CDS coordinates: 83-544 (+)
• Peptide sequence: MDTEKLARMQNAARTGGKGTPRRVQKKVHRSSGADDQKLQATLKKMNVQPITQIEEVNMFKSDGNVIHFSAPKVHAAVPSNTFALYGHGEDKELTELVPGILNQLGPDSLASLRKLAESYQSLQKGAEGEKKDEDDDEIPELVEGENFESKVE*
• ORF Type: complete

Annotations of Ll_transcript_269849

• Blastp: Nascent polypeptide-associated complex subunit beta from Aspergillus with 76.97% of identity
• Blastx: Nascent polypeptide-associated complex subunit beta from Aspergillus with 80% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (ACLA_097690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236570.1)
• Pfam: NAC domain (PF01849.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;