Protein coding transcript 131871

• Transcript: Ll_transcript_269843
• CDS coordinates: 17-331 (+)
• Peptide sequence: MKVFAVISVFLLAFAAVSAELTDEQQKKIIENRENCVKETGVDPEMIDRADVGDFTDDPKLQCFAKCFYQKAGFVNDKGEIVMETLKAKLPEENKEEALAIIEKC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_269843

• Blastp: General odorant-binding protein 56d from Sophophora with 36.45% of identity
• Blastx: General odorant-binding protein 56d from Sophophora with 36.45% of identity
• Eggnog: Odorant-binding protein(ENOG410ZCHW)
• Kegg: Link to kegg annotations (Dmel_CG11218)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450366.1)
• Pfam: PBP/GOBP family (PF01395.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;