Protein coding transcript 131872

• Transcript: Ll_transcript_269842
• CDS coordinates: 1-309 (+)
• Peptide sequence: FGGLFNKGSESLPNPLEQASGLERKQLLAELQGNEDPFDMNIQKRGVCTKEQPHVVKSYFHERLVGCICEEDSENIVWMWLRQNEPKRCACGYWFKLKKVEE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269842

• Blastp: Cytochrome c oxidase subunit 5B, mitochondrial from Bos with 44.83% of identity
• Blastx: Cytochrome c oxidase subunit 5B, mitochondrial from Bos with 44.83% of identity
• Eggnog: cytochrome C oxidase(ENOG4111XEM)
• Kegg: Link to kegg annotations (287012)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001241975.1)
• Pfam: Cytochrome c oxidase subunit Vb (PF01215.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;