Protein coding transcript 131876

• Transcript: Ll_transcript_269891
• CDS coordinates: 3-422 (+)
• Peptide sequence: SLLSDAVSFINELKTKINELEKNKCSNNKEVKLVMRDRMKNNKIKATTNSTVVNQRGPNNVEVDVKVVGNDAMVRVQMEKVNHPGARLMGVLRDLNFQVHHASMCCVNDVMLQDVFIKAPNKMRSEEGLKSAILMRLNH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269891

• Blastp: Transcription factor MYC2 from Oryza sativa with 36.5% of identity
• Blastx: Transcription factor MYC2 from Arabidopsis with 40.71% of identity
• Eggnog: anthocyanin-containing compound biosynthetic process(ENOG410YCJJ)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459709.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;