Protein coding transcript 131877

• Transcript: Ll_transcript_269868
• CDS coordinates: 3-323 (+)
• Peptide sequence: PLFNSGRGGVLTEKGTVELEASIMDGPNRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFDGAEDFARKQGVELVDNEYFITPENVGMLKLAKEANTIVFDYRIPI
• ORF Type: internal

Annotations of Ll_transcript_269868

• Blastp: Probable isoaspartyl peptidase/L-asparaginase 2 from Arabidopsis with 86.79% of identity
• Blastx: Probable isoaspartyl peptidase/L-asparaginase 2 from Arabidopsis with 86.79% of identity
• Eggnog: asparaginase(COG1446)
• Kegg: Link to kegg annotations (AT3G16150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438535.1)
• Pfam: Asparaginase (PF01112.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;