Protein coding transcript 131878

• Transcript: Ll_transcript_269898
• CDS coordinates: 235-738 (+)
• Peptide sequence: MGALLKLIDAILFMFFLLIAIVAPLIDAQTIFPISYFPEFFVQLKTNYAQDYGDYLISEKPHFFVGLVWLQLFFQWPLALLNLYAIFASKPWFNTTCLIYGVSVSTTMVAILSELAGSNKASETLLRIYSAFMGLGILAILRGLQGHSSKTNSGHNRRVALARKKHA*
• ORF Type: complete

Annotations of Ll_transcript_269898

• Blastp: Sigma intracellular receptor 2 from Homo with 30.36% of identity
• Blastx: Sigma intracellular receptor 2 from Homo with 30.36% of identity
• Eggnog: Transmembrane protein 97(ENOG4111RR6)
• Kegg: Link to kegg annotations (27346)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448938.1)
• Pfam: Protein of unknown function (DUF2781) (PF10914.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;