| Transcript | Ll_transcript_183368 |
|---|---|
| CDS coordinates | 3-530 (+) |
| Peptide sequence | LSHSSKDEWVISRVFQKSTTGSGGSTVSATTSNSSKKTTPMTTTITTTSVNMSLCLEQPSSPSSVYLPPFLPSSPYTAAAAAAAASTTAFNNTIAEHVSCFSNNNFSNESFGFAPLTLDPFARFQRSFQPPFFFSPAVQPVNGGYFIAPPVEQKVADGGSNIALGPPEFDCMWGY* |
| ORF Type | 5prime_partial |
| Blastp | Protein CUP-SHAPED COTYLEDON 2 from Arabidopsis with 31.29% of identity |
|---|---|
| Blastx | - |
| Eggnog | Protein CUP-SHAPED COTYLEDON(ENOG410Y9VP) |
| Kegg | Link to kegg annotations (AT5G53950) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425179.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer