Protein coding transcript 131887

• Transcript: Ll_transcript_269860
• CDS coordinates: 50-715 (+)
• Peptide sequence: MWKRALLGAAAAAATLRRPFVSSVRSSSTISSAVNSMLLRSLKDHYLEVSKMNLPPKVGPPSPFTIVKGALDSNGPVLKRSYNDEEVSVYVTRLASDEDEDGAIHQLFVHVDVSKPGQKESLNFLCGLYEDALGIHSVSIRPKLQDNAYLLIPSQYTGPVFEELDEKMRDAFHSYIEERGVNESLFKFLQAWLYVKEHRNLLRWFKTTGLFIDGKKPATGA*
• ORF Type: complete

Annotations of Ll_transcript_269860

• Blastp: Uncharacterized protein At2g39795, mitochondrial from Arabidopsis with 26.61% of identity
• Blastx: Mitochondrial acidic protein mam33 from Schizosaccharomyces with 30.56% of identity
• Eggnog: Mitochondrial glycoprotein family protein(ENOG4111MS5)
• Kegg: Link to kegg annotations (AT2G39795)
• CantataDB: Link to cantataDB annotations (CNT0001791)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435600.1)
• Pfam: Mitochondrial glycoprotein (PF02330.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;