Protein coding transcript 131888

• Transcript: Ll_transcript_269861
• CDS coordinates: 1-591 (+)
• Peptide sequence: SLSLYIFDRWGLGFRVLDYLLNYVHFHFALQKVGPPSPFTIVKGALDSNGPVLKRSYNDEEVSVYVTRLASDEDEDGAIHQLFVHVDVSKPGQKESLNFLCGLYEDALGIHSVSIRPKLQDNAYLLIPSQYTGPVFEELDEKMRDAFHSYIEERGVNESLFKFLQAWLYVKEHRNLLRWFKTTGLFIDGKKPATGA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269861

• Blastp: Mitochondrial acidic protein mam33 from Schizosaccharomyces with 41.38% of identity
• Blastx: Mitochondrial acidic protein mam33 from Schizosaccharomyces with 41.38% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC776.07)
• CantataDB: Link to cantataDB annotations (CNT0001791)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435600.1)
• Pfam: Mitochondrial glycoprotein (PF02330.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;