Protein coding transcript 131892

• Transcript: Ll_transcript_236327
• CDS coordinates: 1-477 (+)
• Peptide sequence: KKDSLMDHILSATFEGLNDYDGIARQVGFIWQHVKFTLIVPVLKVLVVLCLVMSIMLFVERVYMGVVIVLVKLFRYKPQKHYVWDPLKEDDLELGNSAYPVVLVQIPMCNEKEVYQLSIGAACELSWPSDRIIVQVLDDSTDPVIKNMVKEECQRWASK
• ORF Type: internal

Annotations of Ll_transcript_236327

• Blastp: Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 65.47% of identity
• Blastx: Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 74.77% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT5G03760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017413765.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;