Transcript | Ll_transcript_236327 |
---|---|
CDS coordinates | 1-477 (+) |
Peptide sequence | KKDSLMDHILSATFEGLNDYDGIARQVGFIWQHVKFTLIVPVLKVLVVLCLVMSIMLFVERVYMGVVIVLVKLFRYKPQKHYVWDPLKEDDLELGNSAYPVVLVQIPMCNEKEVYQLSIGAACELSWPSDRIIVQVLDDSTDPVIKNMVKEECQRWASK |
ORF Type | internal |
Blastp | Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 65.47% of identity |
---|---|
Blastx | Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 74.77% of identity |
Eggnog | Glycosyl transferase, family 2(COG1215) |
Kegg | Link to kegg annotations (AT5G03760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017413765.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer