Transcript | Ll_transcript_236259 |
---|---|
CDS coordinates | 1-489 (+) |
Peptide sequence | NGFQDYSGRIMNSAIVVIFVAILGYSTCAPQRGAFRPQPPGPSGQIIRIISQTQDGPNVDGSYQWSYEAENGIRAQERGQVKGQGPEGGIMDAQGDFSYTAPDGTPISLQYVANEGGFQPQGAHLPTSPPIPEAIQRALAYNAAHPEEDDGGQARGSFNARG* |
ORF Type | 5prime_partial |
Blastp | Endocuticle structural glycoprotein SgAbd-1 from Schistocerca with 60.75% of identity |
---|---|
Blastx | Endocuticle structural glycoprotein SgAbd-1 from Schistocerca with 60.75% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015950703.2) |
Pfam | Insect cuticle protein (PF00379.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer