Protein coding transcript 131894

• Transcript: Ll_transcript_236259
• CDS coordinates: 1-489 (+)
• Peptide sequence: NGFQDYSGRIMNSAIVVIFVAILGYSTCAPQRGAFRPQPPGPSGQIIRIISQTQDGPNVDGSYQWSYEAENGIRAQERGQVKGQGPEGGIMDAQGDFSYTAPDGTPISLQYVANEGGFQPQGAHLPTSPPIPEAIQRALAYNAAHPEEDDGGQARGSFNARG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236259

• Blastp: Endocuticle structural glycoprotein SgAbd-1 from Schistocerca with 60.75% of identity
• Blastx: Endocuticle structural glycoprotein SgAbd-1 from Schistocerca with 60.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015950703.2)
• Pfam: Insect cuticle protein (PF00379.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;