Protein coding transcript 131896

• Transcript: Ll_transcript_236238
• CDS coordinates: 506-1093 (+)
• Peptide sequence: MILVYALGHISGAHFNPAVTVSFAIYRQFPLKQVPLYLIAQVLGSILASGTLYLLYDDLDENSYFGTVPVGAHLKSFILEILTSFLLMFVVSAVSTDNRAIGELAGIAVGMTVLIDVFIAGPVSGASMNPARSLGPAVVMHIFDGFWLYIVGPFLGAILGASAYNLIRFTEKPLREIGASSTILKSMSRVSTFRR*
• ORF Type: complete

Annotations of Ll_transcript_236238

• Blastp: Probable aquaporin NIP-type from Nicotiana with 62.9% of identity
• Blastx: Probable aquaporin NIP-type from Nicotiana with 63.64% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446399.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;