Protein coding transcript 1319

• Transcript: Ll_transcript_358607
• CDS coordinates: 3-941 (+)
• Peptide sequence: NNQQQNKKMSPLSFSNLQTLPPISSNHRPKPPPLASPAGSRRRMLYICCAEGGGRVKRTSTDDYHGTLKALNSKGRFPRKSLGQHYMLNSDINEQLAGVACIEPGDVVLEIGPGTGSLTNVLLNSGAFVLAVEKDKHMAALVSERFSSTGKFKILTEDFVKCHVRSHMSSLVESLKQMDQETRNAKVVANIPFNISTDVIKLLLPMGDIFSEVVLLLQEETALRLVVSSLRTSEYRPINIFVNFYSDPEYKFKVPRTHFFPQPNVDAAVVSFKLKPPTRYPQVSSSKSFFSMVALSPTCTIISFFEFLGIFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_358607

• Blastp: Ribosomal RNA small subunit methyltransferase, chloroplastic from Arabidopsis with 68.22% of identity
• Blastx: Ribosomal RNA small subunit methyltransferase, chloroplastic from Arabidopsis with 68.22% of identity
• Eggnog: Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits (By similarity)(COG0030)
• Kegg: Link to kegg annotations (AT1G01860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464969.1)
• Pfam: Ribosomal RNA adenine dimethylase (PF00398.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;