| Transcript | Ll_transcript_236290 |
|---|---|
| CDS coordinates | 3-344 (+) |
| Peptide sequence | KLEFVRKLQDLEVTEKQLAVLEVEITSDTADVVWKKEGKVLDDANIKYTLEKDGGVRKLIIRSASIHDEGEYICTLLDQDCKGDVTVIELPPEIIGPLQDQTVKKGDKTVFEIE |
| ORF Type | internal |
| Blastp | Titin from Sophophora with 46.49% of identity |
|---|---|
| Blastx | Titin from Sophophora with 46.49% of identity |
| Eggnog | IG_like(ENOG410XTJ8) |
| Kegg | Link to kegg annotations (Dmel_CG1915) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004493443.1) |
| Pfam | Immunoglobulin I-set domain (PF07679.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer