Transcript | Ll_transcript_236290 |
---|---|
CDS coordinates | 3-344 (+) |
Peptide sequence | KLEFVRKLQDLEVTEKQLAVLEVEITSDTADVVWKKEGKVLDDANIKYTLEKDGGVRKLIIRSASIHDEGEYICTLLDQDCKGDVTVIELPPEIIGPLQDQTVKKGDKTVFEIE |
ORF Type | internal |
Blastp | Titin from Sophophora with 46.49% of identity |
---|---|
Blastx | Titin from Sophophora with 46.49% of identity |
Eggnog | IG_like(ENOG410XTJ8) |
Kegg | Link to kegg annotations (Dmel_CG1915) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004493443.1) |
Pfam | Immunoglobulin I-set domain (PF07679.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer