Protein coding transcript 131904

• Transcript: Ll_transcript_236307
• CDS coordinates: 46-600 (+)
• Peptide sequence: MRETAESYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKQEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFSNEFKRKHKKDLSANARALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCQDLFR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_236307

• Blastp: Heat shock 70 kDa protein 2 from Paracoccidioides with 96.22% of identity
• Blastx: Heat shock 70 kDa protein 2 from Paracoccidioides with 95.5% of identity
• Eggnog: Heat shock protein(COG0443)
• Kegg: Link to kegg annotations (PAAG_08003)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016172252.1)
• Pfam: Hsp70 protein (PF00012.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;