Protein coding transcript 131909

• Transcript: Ll_transcript_236291
• CDS coordinates: 1-549 (+)
• Peptide sequence: EKIVRGFCHLYSGQEACAVGMKAMFRDTDSIITAYRAHGWTYLMGVDPFNVLSELTGRKSGNARGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALAAKYLGTGGVCFTLYGDGAANQGQVFEAYNMSKLWDIPVVYVCENNGYGMGTSSERASASVAYYTRGDYIPGIWVDGMDVLAVREAA
• ORF Type: internal

Annotations of Ll_transcript_236291

• Blastp: Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial from Caenorhabditis with 74.73% of identity
• Blastx: Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial from Caenorhabditis with 74.73% of identity
• Eggnog: Dehydrogenase(COG1071)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423869.1)
• Pfam: Dehydrogenase E1 component (PF00676.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;