Protein coding transcript 131912

• Transcript: Ll_transcript_236224
• CDS coordinates: 774-1115 (+)
• Peptide sequence: MQVYATWRKMWLSKGEEHEARKKELISIFKLLEETLGDKTFYGGDTFGFVDVNLIPFYSWFYTFETFGNFKMEEECPKLIAWAKKCLQKESVSKSLPDEKKVYEYIVALQKAH*
• ORF Type: complete

Annotations of Ll_transcript_236224

• Blastp: Glutathione S-transferase 3 from Soja with 72.97% of identity
• Blastx: Glutathione S-transferase 3 from Soja with 81.13% of identity
• Eggnog: glutathione Stransferase(ENOG410XSIX)
• Kegg: Link to kegg annotations (547925)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443777.1)
• Pfam: Glutathione S-transferase, C-terminal domain (PF00043.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;