| Transcript | Ll_transcript_236324 |
|---|---|
| CDS coordinates | 56-361 (+) |
| Peptide sequence | MKYFFHILFLSAMLITYVIAYSESPQHKGSQIFTSSKNNNSSKNSYKYGGGHMSCDKYPRVCDVKGSEGHDCCRKKCVNVSRDRNNCGECGKRCKYLETCCK |
| ORF Type | 3prime_partial |
| Blastp | Stigma-specific STIG1-like protein 1 from Arabidopsis with 42.31% of identity |
|---|---|
| Blastx | Stigma-specific STIG1-like protein 1 from Arabidopsis with 42.31% of identity |
| Eggnog | Stigma-specific protein, Stig1(ENOG4111VQ8) |
| Kegg | Link to kegg annotations (AT4G26880) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020220217.1) |
| Pfam | Stigma-specific protein, Stig1 (PF04885.12) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer