Transcript | Ll_transcript_236318 |
---|---|
CDS coordinates | 1-507 (+) |
Peptide sequence | SRCCVCRDNKMTNPKGYRRGTRDLFSRKFRTKGVIPLSTYMKVYKIGDIVDIKGNGAIQKGMPHKSYHGRTGRVFNVTQHALGVIVNKRVRGKILPKRINIRIEHVTHSKCREDFLRRVKENERLRKEGRASGVMAIVKRQPQGPRPAHTVKGQELIHLAPIPYEFVA* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L21 from Homo with 64.38% of identity |
---|---|
Blastx | 60S ribosomal protein L21 from Homo with 64.38% of identity |
Eggnog | (ribosomal) protein(COG2139) |
Kegg | Link to kegg annotations (6144) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426279.1) |
Pfam | Ribosomal protein L21e (PF01157.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer