Protein coding transcript 131915

• Transcript: Ll_transcript_236313
• CDS coordinates: 1-303 (+)
• Peptide sequence: KNMAGRNNYDDRDGSQYSSRRGGGKKQLPSEPPFTAYIGNLPYGIVQGDVNRIFKDFGVKNIRLVMDKETDRFKGFCYVEFATVQDLENAILMNGMVEVEG
• ORF Type: internal

Annotations of Ll_transcript_236313

• Blastp: Eukaryotic translation initiation factor 4H from Pongo with 56.16% of identity
• Blastx: Eukaryotic translation initiation factor 4H from Pongo with 56.16% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (100172357)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017433635.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;