Protein coding transcript 131917

• Transcript: Ll_transcript_236308
• CDS coordinates: 145-588 (+)
• Peptide sequence: MDDDQQFCLRWNNHQSTLVAVFDTLLENGTLVDCTLAAEGKCLNAHKVVLSACSPYFESLLSRHFDKHPILILKDVKFQELKAMMDYMYRGEVNISQDQLGALLKAAESLQIKGLSDNKRGETERKPAPAPPPSKSPQPAAALPKVQG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_236308

• Blastp: Longitudinals lacking protein, isoforms H/M/V from Sophophora with 79.41% of identity
• Blastx: Longitudinals lacking protein, isoforms H/M/V from Sophophora with 85.95% of identity
• Eggnog: BTB/POZ domain(ENOG4111M67)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003592432.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;