Protein coding transcript 131918

• Transcript: Ll_transcript_236309
• CDS coordinates: 2-565 (+)
• Peptide sequence: LTIEQRSREDSREGSQSPGPRKKKRMRRKSEDMDNHDASNSSESHSLPAQNIPSSLPAVSKLNADVPEPVETKSDILTRHKQDEIPQVPIIKEKLETHTELMLEPKSEYVEEMNEDSIEDLTLDDDDLSNMEQMDDGAGPSHGNMGEGSSQGFGWHMGNQSQDEVFLAAQEAVGAHRDSQAQDLRVKR
• ORF Type: internal

Annotations of Ll_transcript_236309

• Blastp: Longitudinals lacking protein, isoforms F/I/K/T from Sophophora with 45.78% of identity
• Blastx: Longitudinals lacking protein, isoforms F/I/K/T from Sophophora with 45.78% of identity
• Eggnog: BTB/POZ domain(ENOG4111M67)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;