Protein coding transcript 131920

• Transcript: Ll_transcript_236338
• CDS coordinates: 3-566 (+)
• Peptide sequence: ILRRKKVGNLKLQSTFSFKYLVSKNSGSKEKVEDLFNKPNSSVLLQKPELMFSPKPFKHHCDDVAAIKLQKVYKSYRTRRNLADCAVICEELWWKTMNFAACTSQYDSETAFLKWTRASNNAAKVGKDLSKDDRAQKLALRHWLEAIDPRHRYGHNLDFYYDVWFQSQSSQPFFYWLDIGDGKEVNLE
• ORF Type: internal

Annotations of Ll_transcript_236338

• Blastp: IQ domain-containing protein IQM5 from Arabidopsis with 56.12% of identity
• Blastx: IQ domain-containing protein IQM5 from Arabidopsis with 56.12% of identity
• Eggnog: Calmodulin-binding(ENOG410XYNX)
• Kegg: Link to kegg annotations (AT5G57010)
• CantataDB: Link to cantataDB annotations (CNT0000733)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458373.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;