Protein coding transcript 131926

• Transcript: Ll_transcript_236334
• CDS coordinates: 1-675 (-)
• Peptide sequence: CDQNWSTQVSDSLAASIIHALNTIWFCRNQFRFQDRCISKHQALARIKLATFHSGNNSNGCANNSMQDFSILHSLGIQSKFRKSPKITEVTWLPPAHGRIKINSYGVAHGAPGQAGGGAVFRDHDGNFLACFATYFDVQDALFAELLSAILTIEFAYDRGWNTIWLECDSSLVVDIFSDRIIPPWKLRNKWIRCKEIMVSMDWFISHIYRESNSCADKLANFGIM
• ORF Type: internal

Annotations of Ll_transcript_236334

• Blastp: Putative ribonuclease H protein At1g65750 from Arabidopsis with 26.24% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 31.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431188.1)
• Pfam: Reverse transcriptase-like (PF13456.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;