Protein coding transcript 131932

• Transcript: Ll_transcript_195102
• CDS coordinates: 2-304 (+)
• Peptide sequence: EELFRSVGTSRKHYVPKGLKSMSVVSEEYLRHEEKQIPLDEVFLYKYLKQRPKQNKKHAENPDEDGFSDVDSVNSDDFNELLDGMMGAKKKKKYEFSRGFE
• ORF Type: internal

Annotations of Ll_transcript_195102

• Blastp: CCAAT/enhancer-binding protein zeta from Mus with 36.99% of identity
• Blastx: -
• Eggnog: CCAAT enhancer binding protein (C EBP), zeta(COG5593)
• Kegg: Link to kegg annotations (12607)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015968495.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;