Protein coding transcript 131943

• Transcript: Ll_transcript_195076
• CDS coordinates: 78-554 (+)
• Peptide sequence: MSEKYIVTWDMLQIHTRKLANRLVKKIHSWNGIIAVSRGGLVPSALLARELGLRCVDTVCIESYNYDCLKENRKIIKKAEGNGEKIIVIDDLVDTGGTAKIIRKLYPKACFVTIFAKPMGRSLVDNYIIDIPQNVWIEQPWDMSISYIPPLIQNYKIK*
• ORF Type: complete

Annotations of Ll_transcript_195076

• Blastp: Xanthine phosphoribosyltransferase from Buchnera with 100% of identity
• Blastx: Xanthine phosphoribosyltransferase from Buchnera with 100% of identity
• Eggnog: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis (By similarity)(COG0503)
• Kegg: Link to kegg annotations (BU251)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003536401.2)
• Pfam: Phosphoribosyl transferase domain (PF00156.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;