Transcript | Ll_transcript_195098 |
---|---|
CDS coordinates | 1-417 (+) |
Peptide sequence | FQVETRPRIIAALWHYINSRKLEISNDPFSFICDPSLQMLFGANKMEFEEAIKKLPQHLSLPQPINLEHEIKLSGNPTSDTDCYDIQVYVHPPLDNDISSILAGRESQKQIEFFDDVISSYIKKVHEHQRRRAFFHSFS |
ORF Type | internal |
Blastp | SWI/SNF complex component SNF12 homolog from Arabidopsis with 51.8% of identity |
---|---|
Blastx | SWI/SNF complex component SNF12 homolog from Arabidopsis with 51.8% of identity |
Eggnog | SWI SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member(COG5531) |
Kegg | Link to kegg annotations (AT5G14170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434318.1) |
Pfam | SWIB/MDM2 domain (PF02201.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer