Protein coding transcript 131944

• Transcript: Ll_transcript_195098
• CDS coordinates: 1-417 (+)
• Peptide sequence: FQVETRPRIIAALWHYINSRKLEISNDPFSFICDPSLQMLFGANKMEFEEAIKKLPQHLSLPQPINLEHEIKLSGNPTSDTDCYDIQVYVHPPLDNDISSILAGRESQKQIEFFDDVISSYIKKVHEHQRRRAFFHSFS
• ORF Type: internal

Annotations of Ll_transcript_195098

• Blastp: SWI/SNF complex component SNF12 homolog from Arabidopsis with 51.8% of identity
• Blastx: SWI/SNF complex component SNF12 homolog from Arabidopsis with 51.8% of identity
• Eggnog: SWI SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member(COG5531)
• Kegg: Link to kegg annotations (AT5G14170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434318.1)
• Pfam: SWIB/MDM2 domain (PF02201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;