Transcript | Ll_transcript_195066 |
---|---|
CDS coordinates | 2-376 (+) |
Peptide sequence | CNPTQTCQRNLGAFCQCNQKSRTRAMAYLRSILRQGLQKKYGLNLYNFNLQQQSSLPKSTAAQTVVQSNQEVSKQPKDALDITFEDARAAFKSKTNWELIRAYIVYTLCSFETLVDNNMKLMKFA |
ORF Type | internal |
Blastp | Proline dehydrogenase 1, mitochondrial from Sophophora with 47.67% of identity |
---|---|
Blastx | Proline dehydrogenase 1, mitochondrial from Sophophora with 47.67% of identity |
Eggnog | Proline dehydrogenase(COG0506) |
Kegg | Link to kegg annotations (Dmel_CG1417) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003543204.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer