Protein coding transcript 131947

• Transcript: Ll_transcript_195066
• CDS coordinates: 2-376 (+)
• Peptide sequence: CNPTQTCQRNLGAFCQCNQKSRTRAMAYLRSILRQGLQKKYGLNLYNFNLQQQSSLPKSTAAQTVVQSNQEVSKQPKDALDITFEDARAAFKSKTNWELIRAYIVYTLCSFETLVDNNMKLMKFA
• ORF Type: internal

Annotations of Ll_transcript_195066

• Blastp: Proline dehydrogenase 1, mitochondrial from Sophophora with 47.67% of identity
• Blastx: Proline dehydrogenase 1, mitochondrial from Sophophora with 47.67% of identity
• Eggnog: Proline dehydrogenase(COG0506)
• Kegg: Link to kegg annotations (Dmel_CG1417)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003543204.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;