Protein coding transcript 131950

• Transcript: Ll_transcript_195126
• CDS coordinates: 2-451 (+)
• Peptide sequence: GVIVAVNFSSAKTKMLDEYLGKKYELHDSQNFDEFMKALGVGFLTRKLGAAASPVVDLTKEGDEYTLTSVSTFKNVILKFKPGVEFDQETPDGRNVKATITVDGATLHEVQKDSAGKTTIIDRTWSPEEVKMVMSIDNITATRIYKAMP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_195126

• Blastp: Fatty acid-binding protein, muscle from Schistocerca with 47.06% of identity
• Blastx: Fatty acid-binding protein, muscle from Schistocerca with 47.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020958592.1)
• Pfam: Lipocalin / cytosolic fatty-acid binding protein family (PF14651.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;