Protein coding transcript 131952

• Transcript: Ll_transcript_195109
• CDS coordinates: 2-343 (+)
• Peptide sequence: FVTASKDKTSKLFDVDDLSVHKVYVTERPVNSASLSPKYDHVVLGGGQDAMDVTTTAAQAGKFDARFFHVIFEEEFARVKGHFGPINSLAFHPDGESFSTGGEDGFIRVQSFDP
• ORF Type: internal

Annotations of Ll_transcript_195109

• Blastp: Eukaryotic translation initiation factor 3 subunit I from Hawaiian Drosophila with 76.11% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit I from Hawaiian Drosophila with 76.11% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XQ3E)
• Kegg: Link to kegg annotations (Dgri_GH10244)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004492932.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;