Protein coding transcript 131956

• Transcript: Ll_transcript_195088
• CDS coordinates: 105-632 (+)
• Peptide sequence: MKEEILQFNWGKKRGIGGKKKDVQFYDSFTYDHVEYNLFDNVFLHKDDESDPYIGKIIKIWEHRDASKKVKVLWFFHPHEIRNFLEGIQSPCDNELFLASGEGAGLANVNPLESVAGKCNIICTSKDTRNRQPSDEELKMAEFVFYRFFDVGSRKVVDKLDDKIAGVDVKNMFNK*
• ORF Type: complete

Annotations of Ll_transcript_195088

• Blastp: Protein ANTI-SILENCING 1 from Arabidopsis with 60.38% of identity
• Blastx: Protein ANTI-SILENCING 1 from Arabidopsis with 59.89% of identity
• Eggnog: BAH domain(ENOG410YFGH)
• Kegg: Link to kegg annotations (AT5G11470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447454.1)
• Pfam: BAH domain (PF01426.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;