Protein coding transcript 131957

• Transcript: Ll_transcript_195113
• CDS coordinates: 69-809 (+)
• Peptide sequence: MDHTTPSTALAYLNPRYWDQRFSEEEQYEWFKDYSHFRHLIHSHLTPNSSVLELGCGNSQMCEELHKDGAIDITCIDLSHVAVDNMQRRLLSRGLNDIKVLQADMLELPFGDECFDLVIEKGTMDVLFVDSGDPWNPKPETISKVMATLKGVHRVLKANGIFISITFGQPHFRRPIFNAPDFSWSVEWTTFGETFHYFVYVLKKGQRSSYEDIPIKRSEAPRINLVHEELESEDFAFLINVDELNS*
• ORF Type: complete

Annotations of Ll_transcript_195113

• Blastp: Methyltransferase-like protein 13 from Sophophora with 32.54% of identity
• Blastx: Methyltransferase-like protein 13 from Sophophora with 32.54% of identity
• Eggnog: methyltransferase like 13(ENOG410XNZZ)
• Kegg: Link to kegg annotations (Dmel_CG2614)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413183.1)
• Pfam: Methionine biosynthesis protein MetW (PF07021.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;