Protein coding transcript 131958

• Transcript: Ll_transcript_195122
• CDS coordinates: 119-487 (+)
• Peptide sequence: MRLLTHNMLSSNIKGVTNGFPLRIEAVKVEEKTVEMNTDFLKNMFVKIDWKVLVEASRTLGYAELPEEGDSSFLESDEFLSRFHHALLELHLEEGALICPETGRRFPVTKGIPNMLLHEDEV*
• ORF Type: complete

Annotations of Ll_transcript_195122

• Blastp: Multifunctional methyltransferase subunit TRM112-like protein At1g78190 from Arabidopsis with 69.35% of identity
• Blastx: Multifunctional methyltransferase subunit TRM112-like protein At1g22270 from Arabidopsis with 73.39% of identity
• Eggnog: tRNA methyltransferase 11-2 homolog(ENOG4111NTJ)
• Kegg: Link to kegg annotations (AT1G78190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416105.1)
• Pfam: Trm112p-like protein (PF03966.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;