Protein coding transcript 131960

• Transcript: Ll_transcript_195141
• CDS coordinates: 2-334 (-)
• Peptide sequence: MSSSLKSSSTSPYSKYEIRNRNPNPKSCALLVIDMQNYFSSMATPILPHLNTTISLCRRASIPVFFTRHRHKSPSDYGMLGEWWSGDLVFDGTPEAELMEALDRDGDDMVV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_195141

• Blastp: Nicotinamidase 2 from Arabidopsis with 60.95% of identity
• Blastx: Nicotinamidase 2 from Arabidopsis with 64.29% of identity
• Eggnog: isochorismatase(COG1535)
• Kegg: Link to kegg annotations (AT5G23230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420688.1)
• Pfam: Isochorismatase family (PF00857.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;