Transcript | Ll_transcript_195141 |
---|---|
CDS coordinates | 2-334 (-) |
Peptide sequence | MSSSLKSSSTSPYSKYEIRNRNPNPKSCALLVIDMQNYFSSMATPILPHLNTTISLCRRASIPVFFTRHRHKSPSDYGMLGEWWSGDLVFDGTPEAELMEALDRDGDDMVV |
ORF Type | 3prime_partial |
Blastp | Nicotinamidase 2 from Arabidopsis with 60.95% of identity |
---|---|
Blastx | Nicotinamidase 2 from Arabidopsis with 64.29% of identity |
Eggnog | isochorismatase(COG1535) |
Kegg | Link to kegg annotations (AT5G23230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420688.1) |
Pfam | Isochorismatase family (PF00857.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer