Transcript | Ll_transcript_195065 |
---|---|
CDS coordinates | 75-512 (+) |
Peptide sequence | MSMIPCIFGTGRSINFGRNPFTTTTTTNDTSTITNAHINWTETPEAHIFKVDLPGLKNGDVKVDMLAGRVLQISGDWNKEKKEKEKNDTVRRLERSGGNFVRRFRLPENAKVEKVKACMENGVLTITVPKEEVKKPYLKLVQIKG* |
ORF Type | complete |
Blastp | 17.5 kDa class I heat shock protein from Soja with 55.41% of identity |
---|---|
Blastx | 17.5 kDa class I heat shock protein from Soja with 56.13% of identity |
Eggnog | response to heat(COG0071) |
Kegg | Link to kegg annotations (100791172) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455843.1) |
Pfam | Hsp20/alpha crystallin family (PF00011.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer