Protein coding transcript 131972

• Transcript: Ll_transcript_195168
• CDS coordinates: 3-677 (+)
• Peptide sequence: WRQVVFIMTSKVSRDTFYECVQGVLDQSKAKKRNFLETVEIQIGLKNYDPQKDKRFSGTVKLKHIPRPKMQVCVLGDQQHCDEAKAQGVPFMDVEALKKLNKNKKLVKKLAKKYDAFLASEALIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKATIKFQMKKVLCLSVAVGHVDMSVDELVQNVHLSINFLVSLLKKHWQNVRSLHVKSSMGPPQRLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_195168

• Blastp: 60S ribosomal protein L10a from Spodoptera with 89.86% of identity
• Blastx: 60S ribosomal protein L10a from Spodoptera with 89.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447661.1)
• Pfam: Ribosomal protein L1p/L10e family (PF00687.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;