| Transcript | Ll_transcript_195169 |
|---|---|
| CDS coordinates | 101-568 (+) |
| Peptide sequence | MQVCVLGDQQHCDEAKAQGVPFMDVEALKKLNKNKKLVKKLAKKYDAFLASEALIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKATIKFQMKKVLCLSVAVGHVDMSVDELVQNVHLSINFLVSLLKKHWQNVRSLHVKSSMGPPQRLY* |
| ORF Type | complete |
| Blastp | 60S ribosomal protein L10a from Spodoptera with 91.61% of identity |
|---|---|
| Blastx | 60S ribosomal protein L10a from Spodoptera with 91.41% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442986.1) |
| Pfam | Ribosomal protein L1p/L10e family (PF00687.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer