Protein coding transcript 131981

• Transcript: Ll_transcript_271231
• CDS coordinates: 1-792 (+)
• Peptide sequence: KGMRAIIRKKPYPIELCTYVLWKERKKEIVKYMATFHLAPFPSFTTLLSQKPFHSFHFRTTHSMKTVCSSSAYKVVVEHEGKTRVEADQNILSKPLDSASSSSRRHVLVRVGTSLVTMTLSPLMAWAQEMSADKEEGDGKGIISAIESLFDPNEKTKSGKVLPKAYLKSAKEVVKTLRESLNEASDDNAKFRRTADMAKESIREYLGTWRGQQSVVQEESYVVLEKAIRSLAKFYSRAGPSTPLSEEVKSEILDYLNTVEQFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_271231

• Blastp: Photosystem II D1 precursor processing protein PSB27-H2, chloroplastic from Arabidopsis with 54.45% of identity
• Blastx: Photosystem II D1 precursor processing protein PSB27-H2, chloroplastic from Arabidopsis with 63.76% of identity
• Eggnog: NA(ENOG4111U0T)
• Kegg: Link to kegg annotations (AT1G05385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427868.1)
• Pfam: Photosystem II Pbs27 (PF13326.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;