Protein coding transcript 131982

• Transcript: Ll_transcript_271232
• CDS coordinates: 1216-1656 (+)
• Peptide sequence: MTLSPLMAWAQEMSADKEEGDGKGIISAIESLFDPNEKTKSGKVLPKAYLKSAKEVVKTLRESLNEASDDNAKFRRTADMAKESIREYLGTWRGQQSVVQEESYVVLEKAIRSLAKFYSRAGPSTPLSEEVKSEILDYLNTVEQFL*
• ORF Type: complete

Annotations of Ll_transcript_271232

• Blastp: Photosystem II D1 precursor processing protein PSB27-H2, chloroplastic from Arabidopsis with 64.38% of identity
• Blastx: Photosystem II D1 precursor processing protein PSB27-H2, chloroplastic from Arabidopsis with 63.76% of identity
• Eggnog: NA(ENOG4111U0T)
• Kegg: Link to kegg annotations (AT1G05385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427868.1)
• Pfam: Photosystem II Pbs27 (PF13326.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;