Protein coding transcript 131994

• Transcript: Ll_transcript_271335
• CDS coordinates: 98-598 (+)
• Peptide sequence: MHYTKLINKHFFYKQQILVMAKFSIKKKGGKSSIVKFKFVVEKLQKKLLLVRNKTSFNFEKYEEGRSDSSYVPDDVKEGHFAVIAEGGDEPKRLVMPLSCLTNSTFLKLLAQAEEEYGYDHEGALTFPCRASDLERILTQQWHEERGYSQTSGLRWSSSNQYMLQT*
• ORF Type: complete

Annotations of Ll_transcript_271335

• Blastp: Auxin-responsive protein SAUR50 from Helianthus with 39.71% of identity
• Blastx: Auxin-responsive protein SAUR50 from Helianthus with 39.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447835.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;