Protein coding transcript 131999

• Transcript: Ll_transcript_271227
• CDS coordinates: 1-450 (+)
• Peptide sequence: MACNGGGSVETNGGNGTMNGSPRKRPRTEAHSKVTVVLGAQWGDEGKGKVVDMLATEMDVVCRCQGGNNAGHTVVTDGVEYDFHLLPSGIINPNCKSVIGNGVVIHLPGLFDEIEKNEKKGLKNWEKQLVISDRAHLVFDFHQQVDGLQE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_271227

• Blastp: Adenylosuccinate synthetase isozyme 1 A from Salmo with 76.22% of identity
• Blastx: Adenylosuccinate synthetase isozyme 1 A from Salmo with 79.1% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100195168)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003554182.1)
• Pfam: Adenylosuccinate synthetase (PF00709.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;